⌘ Services

Our Capabilities

Company

About Us
Mission
History
Facility
Career
News

Since 1984

Trusted Partner

40+ years of excellence in custom synthesis and bioconjugation services.

Learn More →

Products & Services

Oligonucleotides

Peptides

Molecular Biology

Bioconjugation

Immuno Chemistry

Bioanalytical Services

Oligonucleotide Services ›
Custom Oligo Synthesis ›
Oligo Modification ›
Oligo Bioconjugation ›
Speciality Oligonucleotide Synthesis ›
Analytical & QC Services ›
Development Services ›
Formulation & Product Development ›

Custom Peptide Type ›
Custom Peptide Synthesis ›
Peptide Modifications ›
Specialized Peptide Technologies ›
Catalog Peptides ›
Peptide Bioconjugation ›
Peptide Purification & Analytics ›

Molecular Biology Services ›

Bioconjugation Service ›
Biomolecule Conjugates ›

Immuno Services ›
Antibody Engineering & Conjugation ›

Bioanalytical Services ›

OligoTech at BSI
Oligo Services at BSI
OligoLS RUO
OligoDX Diagnostic
OligoTX Therapeutic

Analytical & QC Services at BSI
Oligo Release QC Services
Oligo Process Development

Analytical Method Development
Oligo Stability Study

Custom Oligos at BSI
Custom DNA Synthesis
HT DNA Plate Oligos
Long DNA Synthesis
Custom RNA Synthesis
HT RNA Plate Oligos
Long RNA Synthesis
Custom siRNA Synthesis
Large-Scale Oligonucleotide ›
Purification Services

Modification by Types ›
Modification by Properties ›
Modification by Applications ›
Modification by Name

Large-Scale Oligonucleotide
Large-Scale DNA Synthesis
Large-Scale RNA Synthesis

Modification by Type at BSI
Hapten‑Tagged/Affinity Ligand
Backbone Modifications
Chelators
Conjugation Modifications
Cross‑Linking Bases
Cleavable & Non-cleavable Linkers
DNA Base Analogs
Fluorescence Dyes
Fluorescence Bases
Internal Modifications
RNA Specific Capping
RNA Base Analogs
Spacer & Linkers
Sugar Modifications
Terminal Modification (Caps)
Quenchers
Intercalators
Halogenated Bases
Phosphorylation Modifier
Reactive Handlers
Redox / Electrochemical
Small Molecule Functional Tags ›

Puromycin-mRNA-Display-Signal

Modification by Property at BSI
2′→5′ phosphodiester linkage
Affinity Binding and Capturing
Affinity & Hybridization Control
Inverted Base Oligo Modifications
Cleavable Fluorescent Probes
Convertible Bases
Deuterated Bases
Degenerate Bases
Fluorescent Quenching Signal Suppression
Intercalator Base Modifications
Metal Chelation Modifications
Non-Canonical Structures
Nuclease Resistance & Stability
Photoswitchable Markers
Photo Regulation
Reverse 5' -> 3' Oligo Synthesis
Universal Bases

Modification by Application at BSI
Antisense (ASO, SSO, Gapmers)
siRNA & miRNA
Delivering and Targeting
Conjugation to Antibody (ADC/AOC)
Epigenetics
Cell Delivery and Uptake
DNA Damage Repair
DNA Cross Linking and Ligation
Mutagenesis and Methylation
Chemical Ligation
Colorimetric Detection
Ligation Blocking
Controlled Release / Cleavable Linkers
Photo-Regulation / Photo Cleavage
Structure–Activity Studies
Modification for Bioorthogonal Conjugation
Chain Terminators
Caged Oligonucleotides
Electrochemical Sensing Readout

Speciality Oligonucleotide Synthesis
Therapeutic Modalities ›
Advanced Chemistries Platforms ›
Advanced Oligo Architecture ›
Conjugation Handle Modifications ›
PCR Detection Probes ›
Hybridization Probes ›
Imaging & Spatial Biology Probes ›
PCR Clamp Technology

Custom Oligo Bioconjugation
Tissue & Receptor Targeting ›
Cellular Uptake & Intracellular Delivery ›
Oligo–Macromolecule Conjugates ›
Oligo-Drug Conjugates (ODCs) ›
Oligo-Small Molecule Conjugates ›
Polymer-Oligo Conjugates ›

Therapeutic Oligo Services
Advanced siRNA Architectures
Antisense Oligo (ASO)
Gapmer ASO
Steric-Blocking ASO
Splice-Switching Oligo (SSO)
Aptamers
miRNA Mimics
Therapeutic Oligo Bioconjugation

Tissue Receptor Targeting Oligo Services
Oligo-GalNAc Conjugation
Oligo-Folate Conjugation
Receptor-Targeting Ligand Conjugates

Cellular Uptake and Delivery Services
Extrahepatic Oligonucleotide Delivery
Peptide-Oligo Conjugates
Lipid-Conjugated Oligos ›
Endosomal Escape Options

Lipid-Modified Oligonucleotide Overview
Saturated Fatty Acid Oligos
Unsaturated Fatty Acid Oligos
Cholesterol & Sterol Oligos
Phospholipid & PEG-Lipid Oligos
Steroid & Vitamin Lipid Oligos
Specialty Lipid/ Nucleolipid Oligo

Oligo-Macromolecule at BSI
Antibody-Oligo Conjugates
Nanobody-Oligo Conjugates
Enzyme-Oligo Conjugates
Oligo–Carrier Protein Conjugates
Recombinant Protein-Oligo Conjugates
Streptavidin-Oligo Conjugates

Oligo-Drug Conjugation Services
Oligo-Drug Conjugates
Cleavable Linker Technologies
Controlled Release Strategies
Bioorthogonal Conjugation

Small Molecule Oligo Conjugates Overview
Delivery Modifiers
Targeting Ligands
Affinity Labels
Fluorescent Labeled Oligos
Biotinylated Oligos

Oligo-Polymer Conjugation Overview
Oligo-PEGylation
Oligo-Synthetic Polymer Conjugates
Oligo-PAMAM Conjugates
Oligo-Biodegradable Polymer Conjugates
Smart Polymer–Oligo Conjugates

Advanced Chemistry Platform Overview
Phosphodiester Linkage Reengineering ›
Advanced Sugar Modified XNA ›
Advance XNA Backbone Analogs
Artificial Base Pair Systems

Phosphodiester Linkage Reengineering Overview
Chiral Phosphorothioate (Rp/Sp)
Phosphonoacetate (PACE)
Phosphoramidate (PN bond)
Peptide Nucleic Acid (PNA)
Morpholino (PMO/TMO)

Sugar Modified XNAs Overview
Bridged Nucleic Acids (LNA/BNA)
Ethylene-Bridge Nucleic Acids (ENA)
Constrained Ethyl Nucleic Acids (cEt)
2'-O-NMA (NMA)
2'-Amino Nucleic Acids (2'-AmNA)
Unlock Nucleic Acids (UNA)

Advanced Oligo Architecture Overview
Circular Oligos
Branched Oligos
Dendrimer Oligonucleotide Synthesis
Multimeric Oligonucleotide Synthesis

Conjugation Handle Overview
Click Chemistry Modifier
Amino Modifiers
Thiol Modifiers
Carbonyl Reactive Modifiers
Carboxyl Modifiers
Multifunctional Modifiers
Crosslinker Modifiers

qPCR Probe Services Overview
Dual-Labeled Probe Technologies
Dual-Labeled Hydrolysis Probes
Molecular Beacon Probes
Scorpion Probes
Plexor Primer
FRET Probes
MGB Probes
Multiplex qPCR Probes
Affinity-Enhanced Probes
Mutation Detection Probes
Pathogen Detection Probes

Hybridization probe service overview
DNA/RNA hybridization probes
PNA Hybridization Probes
Branched DNA (bDNA) Probes
Telomere Probes
Capture probe
Custom Hybridization Probe Sets

Imaging & Spatial Biology Probes Overview
Fluorescent Imaging Probes
Near-Infrared (NIR) Imaging Probes
smFISH Probes
RNA Imaging Probes
MERFISH Probes
seqFISH Probes
Spatial Transcriptomic Probe Sets
OligoPaint Probes
Chromosome Painting Probes
Telomere PNA FISH Probes
Custom Imaging Probe Design

Formulation & Product Development at BSI
Custom Formulation Development
LNP Encapsulation
Packaging & Fill-Finish

PeptideTech at BSI
Research Use Peptides (RUO)
Therapeutic/Clinical Peptides
Diagnostic Peptides
Peptide Release QC

Custom Peptide Synthesis Overview
Standard Peptides
Custom Peptide Libraries
Custom Peptide Arrays
Large-Scale Manufacturing
Long Peptides
Difficult Peptides ›

Hydrophobic Peptides
Cysteine-rich Peptides
Aggregation-prone Peptides

Hydrophobic Peptides
Aggregation-prone Peptides

Peptide Modification Overview
Structural Modifications ›
Functional Modifications ›
Conjugation Chemistry ›
Biological Modifications ›

Structural Modifications Overview
Terminal Modifications ›
Amino Acid Substitutions ›
Backbone Modifications
Side-Chain Functionalization ›
Peptide Cyclization ›

Terminal Modification Overview
N-terminus Modification
C-terminus Modification

Amino Acid Substitution Overview
Stereochemical D-Amino Acids
Non-Proteinogenic (Unnatural) Amino Acids

Side-Chain Functionalization Overview
Cysteine-Specific Chemistry
Lysine-Selective Chemistry

Cyclic Peptide Modification Overview
Head-to-tail Cyclization
Side-chain Cyclization
Terminus-to-side Chain Cyclization

Fluorescent Labeling modification
Stable Isotope Labeling
PEGylation
Biotinylation
Click Chemistry Modifications
Linkers, Spacers & Crosslinking
Site-Specific Peptide Modification
Cleavable & Stimuli-Responsive Linkers
Targeting & Delivery Modification

Peptide Crosslinking Chemistry

Post-Translational Modifications
PTM Overview
Phosphorylated Peptides
Glycopeptides
Acetylated Peptides
Methylated Peptides
Sulfated Peptides
Citrullinated Peptides
Ubiquitinated Peptides
SUMOylated Peptides

Peptide Purification Services
Peptide Analytical Services

Specialized Peptide Technologies Overview
Architecture Engineered Peptides ›
Conformational Engineered Peptides ›
Hybrid Peptide Architecture ›
Functionally Engineered Peptides ›
Advanced Peptide Design & Discovery

Architecture Engineered Peptides Overview
Branched Peptide Synthesis
Multivalent Peptide Synthesis ›

Multivalent Peptides Overview
Multiple Antigen Peptide (MAPs)
Dendrimer Peptides
Multiepitope Peptides
Bispecific Peptides

Conformational Engineered Peptides Overview
Cyclic Peptides
Staple Peptides
Helical Peptides
Macrocyclic Peptides
Bicyclic Peptide

Hybrid Peptide Architecture Overview
Glycopeptides
Lipopeptides
PEGylated Peptides

Functionally Engineered Peptides Overview
Analytical & Quantitative Peptide ›
Detection & Reporter Peptides ›
Affinity & Captured Peptides ›

Targeted Proteomics & Quantitative LC-MS Peptides
Stable Isotope-Labeled Peptides
AQUA Peptides

Detection & Reporter Peptides Overview
Fluorescent-Labeled Peptides
FRET Peptides
Enzyme Reporter Peptides
Photoreactive Peptides

Biotinylated Peptides
Affinity Tag Peptides

Catalog Peptide Libraries
MOG Peptide
Beta Amyloid
Cosmetic Peptide
More Catalog Peptide Listing...

Peptide Bioconjugation
Peptide-Oligonucleotide Conjugation ›
Peptide-Protein Conjugation ›
Peptide-Polymer Conjugation ›
Peptide-Drug Conjugation ›
Peptide-Small Molecule/Ligand Conjugation (Non-Drug) ›
Peptide Imaging Conjugates ›

Peptide-Oligo Overview
Peptide-siRNA Conjugation
Peptide-DNA Conjugation
Peptide-ASO Conjugation
Peptide-PNA Conjugation
Peptide-PMO Conjugation

Peptide-Protein Overview
Peptide Carrier Protein Conjugation
Peptide Enzyme Conjugation
Peptide Antibody Conjugation
Peptide–Recombinant Protein Conjugation

Peptide-Polymer Conjugation Overview
Peptide-PEGylation
Peptide–Synthetic Polymer Conjugation
Peptide–Biodegradable Polymer Conjugation

Peptide–Drug Conjugates (PDCs) Overview
Peptide–Lipid Drug Conjugates
Cleavable Linker Peptide–Drug Conjugates (PDCs)
Site-Specific Peptide-Drug
Oncology Peptide Drug Conjugates

Peptide-Small Molecule/Ligand Overview
Peptide–Fluorophore Conjugates
Peptide–Affinity Tag Conjugates
Peptide–Vitamin / Cofactor Conjugates
Peptide–Targeting Ligand Conjugates
Glycopeptide
Lipopeptide (Peptide-Lipid)
Peptide GalNAc Conjugates

Peptide-Imaging Conjugate Overview
Peptide-Fluorophore Conjugates
Near-infrared Peptide Conjugates
Radiolabeled-Compatible (Chelate) Peptides
Dual-label Imaging Conjugates

Molecular Biology Services at BSI
Long RNA Transcript Services
mRNA Transcription Services
Gene and DNA Synthesis
Cloning & Vector Construction
Plasmid DNA Preparation
Protein Expression
Recombinant Protein Purification
RNA & Protein Delivery (LNP Formulation)
Protein Modification & Bioconjugation

Conjugation Service Overview
Site-Specific Conjugation
Payloads, Label & Tags
Cross Linkers, Spacers
Chemistries & Reactive Handles
Carrier & Delivery System
Surfaces & Solid-Support
Development & scale-up
Analytical Characterization
Application Based Conjugation

Biomolecule Conjugates
Antibody Bioconjugates
Oligo Conjugates
Peptide Bioconjugates
Protein Conjugates
Drug Bioconjugates (ODC)
Small Molecule/Hapten Conjugates
Polymer Bioconjugation ›
Lipid & Liposome Bioconjugates
Glycoconjugates
Nanomaterials ›
Metal Chelator Bioconjugates

Polymer Bioconjugation Overview
PEGylation Bioconjugation
Synthetic Polymer Bioconjugation
Biodegradable Polymer Bioconjugation

Nanomaterials Overview
Gold Nanoparticle Bioconjugation

Antibody Purification
Antibody Characterization
ELISA Development & Optimization

Antibody Engineering and Conjugation Overview
Fluorescent Labeling
Secondary Detection Probes
Enzyme Labeling (HRP, AP)
Biotin Conjugation
Nanoparticle Conjugation
Oligonucleotide Conjugation
Antibody Drug Bioconjugation (ADC)
Small Molecule / Ligand Conjugation
Liposome Conjugation
Polymer Conjugation
Fragmentation

Amino Acid Analysis
Endotoxin Assay
Mass Spectrometry
Peptide Identity Confirmation
Peptide Counterion Analysis
Bioburden Assay
Salt-Sodium Content Analysis
Water Content Analysis
Residual Chemical Analysis
pH Analysis
Solubility Testing
Time-Schedule Stability Study
Customer / Bundled Panel

Custom Solutions

Designed for your research & pipeline

High Quality

Rigorous QC and on-time delivery

Scalable Manufacturing

From bench-scale to commercial scale

Expert Support

Scientist-to-scientist consultation

Need help finding the right solution?

Speak to a Scientist →

Resources

Educational Resources ›
Scientific Tools ›

Educational Articles
Frequently Asked Questions
Literature Vault
Newsletters

Oligo Properties Calculator
Peptide Properties Calculator
Peptide Design Library
PNA Properties Calculator
Bioinformatic Glossary
Genetic Code Table
Unit Conversion Tables

Free Tools

Scientific Resources

Calculators, design tools, and educational content to support your research.

Explore →

Contact Quote Order Login / Register

Synthetic, Designed & Source-Independent Products

Synthetic, Designed & Source-Independent

Basic Fibroblast Growth Factor (FGF) Inhibitory Peptide

Calpain Inhibitors

Casein Kinase Substrates

CDR-H3/C2

Cell Penetrating Peptide for Drug Delivery

Drug Carriers

Enzyme Substrates and Inhibitors

FRET Peptides Products

Gastric Inhibitory Polypeptides (GIPs) and Fragments

GM-CSF Inhibitory Peptides

HSV-1 Proteinase Substrates

Human Herpes Virus 8 (HHV-8) Protease Substrate

Human Rhinovirus-14 (HRV14) 2A Protease Substrates

Human Rhinovirus-14 (HRV14) 3C Protease Substrates

Inhibitors

Kinases/Phosphatase Substrates

Kininogen-Based Thrombin Inhibitor and Analogs

Malaria Aspartyl Proteinase Substrate

Peptide Standards

Protease Inhibitors

QA-GSH

Renin Inhibitors

Renin Substrates

Secretase Inhibitors and Substrates

Substrates

ALL

αβδγ

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

Product Name	Catalog #	Unit	Price/Unit
[D - Tyr6, ß - Ala11, Phe13, Nle14] - Bombesin (6 - 14) yQWAV - (ß - A) - HF - Nle - NH2	14292-01	1 mg	$467	Cart Inquire
2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL EDANS - CO - CH2 - CH2 - CO - ALERMFLSFP - Dap(DABCYL)OH	14504-01	1 mg	$801	Cart Inquire
2A/2B Dengue Protease Substrate Ac-RTSKKR-pNA	10996-01	1 mg	$845	Cart Inquire
2B/3, Dengue Protease Substrate Ac-EVKKQR-pNA	10995-01	1 mg	$845	Cart Inquire
3/4A, Dengue Protease Substrate Ac-FAAGRK-pNA	10994-01	1 mg	$845	Cart Inquire
390 MMP FRET Substrate I Mca - PLGL - Dpa - AR - NH2	14505-01	1 mg	$405	Cart Inquire
390 MMP FRET Substrate I Mca - PLGL - Dpa - AR - NH2	14506-01	1 mg	$1,322	Cart Inquire
390 MMP FRET Substrate II Mca - PLGL - Dpa - AR	14507-01	1 mg	$1,283	Cart Inquire
490 MMP FRET Substrate III DABCYL - RPLALWRS - EDANS	14509-01	1 mg	$728	Cart Inquire
520 MMP FRET Substrate I QXL® 520 - PLGLWArK(5 - FAM) - NH2	14511-001	0.1 mg	$521	Cart Inquire
520 MMP FRET Substrate III QXL® 520 - PLGC(Me)HAr - K(5 - FAM) - NH2	14512-001	0.1 mg	$521	Cart Inquire
520 MMP FRET Substrate IX QXL® 520 - RPLALWRK(5 - FAM) - NH2	14513-001	0.1 mg	$521	Cart Inquire
520 MMP FRET Substrate VI QXL® 520 - PLGMWSRK(5 - FAM) - NH2	14515-001	0.1 mg	$521	Cart Inquire
520 MMP FRET Substrate VII QXL® 520 - PYAYWMRK(5 - FAM) - NH2	14516-001	0.1 mg	$521	Cart Inquire
520 MMP FRET Substrate XIV QXL® 520 - γ - Abu - P - Cha - Abu - Smc - HA - Dab(5 - FAM) - AK - NH2 (Smc=S - Methyl - L - cysteine)	14520-001	0.1 mg	$521	Cart Inquire
520 MMP FRET Substrate XV QXL® 520 - γ - Abu - PQGL - Dab(5 - FAM) - AK - NH2	14521-001	0.1 mg	$521	Cart Inquire
580 MMP FRET Substrate I QXL® 570 - KPLA - Nva - Dap(5 - TAMRA) - AR - NH2	14522-001	0.1 mg	$521	Cart Inquire
Activated Protein C (390 - 404), human YGVYTKVSRYLDWIH	11007-01	1 mg	$777	Cart Inquire
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA] Biotinylated Biotin-ARKRERTYSFGHHA	13069-01	1 mg	$467	Cart Inquire
Aminopeptidase N Ligand (CD13) NGR peptide CNGRCG (Disulfide bridge: 1-5)	10857-01	1 mg	$1,619	Cart Inquire
Antennapedia Leader Peptide (CT) KKWKMRRNQFWVKVQRG	10889-01	1 mg	$795	Cart Inquire
Antennapedia Peptide acid RQIKIWFQNRRMKWKK	10866-01	1 mg	$405	Cart Inquire
Antennapedia Peptide, amide RQIKIWFQNRRMKWKK-CONH2	10867-01	1 mg	$777	Cart Inquire
Antennapedia Peptide FAM - labeled 5 - FAM - RQIKIWFQNRRMKWKK - NH2	14364-01	1 mg	$801	Cart Inquire
Anti - BetaGamma (MPS - Phosducin - like protein C AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE	10852-01	1 mg	$1,452	Cart Inquire
Anti - BetaGamma (MPS - Phosducin - like protein C - 10852-005 AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE	10852-005	0.5 mg	$801	Cart Inquire
(Arg)944	10869-01	1 mg	$675	Cart Inquire
(Arg)9 FAM - labeled FAM-RRRRRRRRR	10872-01	N/A	$801	Cart Inquire
(Arg)9 TAMRA - labeled TAMRA-RRRRRRRRR	10873-01	1 mg	$876	Cart Inquire
Bacterial Sortase Substrate I FRET DABCYL - LPETG - EDANS	14523-01	1 mg	$783	Cart Inquire
bFGF (119 - 126), Basic Fibroblast Growth Factor, KRTGQYKL	10492-01	1 mg	$405	Cart Inquire
bFGF Inhibitory Peptide APSGHYKG	10491-01	1 mg	$728	Cart Inquire
bFGF Inhibitory Peptide II MWYRPDLDERKQQKRE	10493-01	1 mg	$878	Cart Inquire
Biotin - TAT (47 - 57) Biotin-YGRKKRRQRRR	10874-01	1 mg	$828	Cart Inquire
Buforin TRSSRAGLQFPVGRVHRLLRK	10886-01	1 mg	$579	Cart Inquire
C105Y, Cell Penetrating Peptide, hα1 - antitrypsin (358-374) CSIPPEVKFNKPFVYLI	10891-01	1 mg	$795	Cart Inquire
C2 substrate, (DABCYL/EDANS) DABCYL -SLGRKIQI-EDANS	11120-01	1 mg	$1,182	Cart Inquire
Cathepsin D and E FRET Substrate Mca - GKPILFFRLK(Dnp) - r - NH2	14524-01	1 mg	$467	Cart Inquire
Cathepsin G (77 - 83) HPQYNQR	10993-01	1 mg	$710	Cart Inquire
Cathepsin L Substrate FITC-LC-EKARVLAEAAK(DABCYL)	11066-01	1 mg	$1,098	Cart Inquire
Cathepsin S Substrate Ac-KQKLR-AMC	11005-01	1 mg	$392	Cart Inquire
CDK5 Substrate [PKTPKKAKKL] PKTPKKAKKL	12330-01	1 mg	$405	Cart Inquire
Cls Substrate, C2 (5 - FAM/ QXL® 520) 5 - FAM - SLGRKIQIQ - K(QXL® 520) - NH2	14525-005	0.5 mg	$764	Cart Inquire
CMV Protease FRET Substrate I	11065-01	1 mg	$1,182	Cart Inquire
Cys-GM-CSF (17-31) CNAIQEARRLLNLSRD	13703-01	1 mg	$1,182	Cart Inquire
Cys(Npys) Antennapedia Peptide, amide C(Npys)RQIKIWFQNRRMKWKK-CONH2	10868-01	1 mg	$828	Cart Inquire
Cys(Npys) - (D - Arg)9 C(Npys)rrrrrrrrr-CONH2	10871-01	1 mg	$966	Cart Inquire
Cys(Npys)-HIV-TAT (47 - 57), amide C(Npys)YGRKKRRQRRR-CONH2	10877-01	1 mg	$828	Cart Inquire
Cys(Npys)-HIV- TAT (47 - 57) amide C(Npys)YGRKKRRQRRR-CONH2	10879-01	5 mg	$2,195	Cart Inquire
Cys(Npys) - TAT (47 - 57), FAM - labeled C(Npys)YGRKKRRQRRRK(FAM)-CONH2	10878-01	1 mg	$1,317	Cart Inquire
Dok - 4 (130 - 145) GVQCEQTDRFNVFLLP	11014-01	1 mg	$845	Cart Inquire
Dok - 4 (263 - 275) LPRSAYWHHITGS	11013-01	1 mg	$743	Cart Inquire
Dok - 5 (263 - 275) LPRSAYWQHITRQ	11011-01	1 mg	$743	Cart Inquire
Dok - 6 (263 - 275) LPRSAYWHHITRQ	11009-01	1 mg	$743	Cart Inquire
FITC - LC - Antennapedia Peptide FITC-LC-RQIKIWFQNRRMKWKK-CONH2	10851-01	1 mg	$801	Cart Inquire
FITC - LC - Antennapedia Peptide-10851-005 FITC-LC-RQIKIWFQNRRMKWKK-CONH2	10851-005	0.5 mg	$504	Cart Inquire
FITC - LC - MTS FITC-LC-AAVLLPVLLAAP-CONH2	10855-01	1 mg	$1,722	Cart Inquire
FITC - LC - TAT (47 - 57) FITC-LC-YGRKKRRQRRR-CONH2	10854-01	1 mg	$1,182	Cart Inquire
GIP, rat YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ	14532-01	1 mg	$1,209	Cart Inquire
GIP, rat YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ	14533-005	0.5 mg	$653	Cart Inquire
GIP (1 - 30), porcine, amide YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-CONH2	11156-01	1 mg	$1,350	Cart Inquire
GIP (3 - 42) human EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	11153-01	1 mg	$1,188	Cart Inquire
GIP human YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	11152-01	1 mg	$822	Cart Inquire
GIP human YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	11152-005	0.5 mg	$507	Cart Inquire
GIP, mouse, rat YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ	11154-01	1 mg	$1,520	Cart Inquire
GIP, porcine YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ	11155-01	1 mg	$1,520	Cart Inquire
GM-CSF (17-31) NAIQEARRLLNLSRD	13702-01	1 mg	$1,182	Cart Inquire
GM-CSF (96-112) CATQIITFESFKENLKD	13704-01	1 mg	$1,215	Cart Inquire
H - Ala - Arg - Arg - AFC ARR-AFC	10982-01	1 mg	$930	Cart Inquire
H - Ala - Leu - Lys - AMC ALK-AMC	10975-01	1 mg	$912	Cart Inquire
H - Ala - Phe - Lys - AMC AFK-AMC	10976-01	1 mg	$845	Cart Inquire
HCV (Hepatitis C Virus) NS3/4A Protease Substrate Ac - DE - Dap(QXL® 520) - EE - Abu - ψ - [COO]AS - C(5 - FAMsp) - NH2	14527-01	1 mg	$2,435	Cart Inquire
H - D - Val - Leu - Arg - AFC vLR-AFC	10988-01	1 mg	$930	Cart Inquire
H - D - Val - Leu - Lys - AFC vLK-AFC	10986-01	1 mg	$930	Cart Inquire
Hemoglobin, 3037a, Malaria FRET Substrate II DABCYL-GABA-ERMFLSFP-EDANS	11122-01	1 mg	$1,115	Cart Inquire
H - Glu - Ala - Ala - Phe - AFC EAAF-AFC	10981-01	1 mg	$945	Cart Inquire
H - Gly - Pro - AMC GP-AMC	10978-01	1 mg	$845	Cart Inquire
HIV Protease FRET Substrate I	11064-01	1 mg	$1,148	Cart Inquire
HIV Protease FRET Substrate I DABCYL - GABA - Ser - Gln - Asn - Tyr - Pro - Ile - Val - Gln - EDANS	14529-01	1 mg	$764	Cart Inquire
HIV-TAT (47 - 57), FAM - labeled FAM-YGRKKRRQRRR	10875-01	1 mg	$1,080	Cart Inquire
HJ Inhibitor Peptide 2 KWWCRW	10997-01	1 mg	$693	Cart Inquire
H - Tyr - Val - Ala - Asp - AFC YVAD-AFC	10980-01	1 mg	$1,283	Cart Inquire
Lipid Membrane Translocating Peptide, D-isomer NE kkaaavllpvllaap	10903-01	1 mg	$912	Cart Inquire
Malaria Aspartyl Proteinase FRET Substrate I	11068-01	1 mg	$1,115	Cart Inquire
Mastoparan INLKALAALAKKIL-CONH2	10853-01	1 mg	$642	Cart Inquire
MEK1 Derived Peptide Inhibitor 1 MPKKKPTPIQLNP	10858-01	1 mg	$728	Cart Inquire
Membrane - Permeable Sequence, MPS AAVALLPAVLLALLAK	10883-01	1 mg	$777	Cart Inquire
MeOSuc - Ala - Ala - Pro - Val - AFC MeOSuc-AAPV-AFC	10990-01	1 mg	$1,047	Cart Inquire
MPG, HIV related GALFLGFLGAAGSTMGAWSQPKSKRKV	10865-01	1 mg	$1,520	Cart Inquire
MPS - Gαi3 AAVALLPAVLLALLAKNNLKECGLY	10882-01	1 mg	$1,065	Cart Inquire
MPS - Gαi2 AAVALLPAVLLALLAKNNLKDCGLF	10881-01	1 mg	$1,065	Cart Inquire
Myristoyl - MEK1 Derived Peptide Inhibitor 1 Myr-MPKKKPTPIQLNP	10859-01	1 mg	$863	Cart Inquire
NGR Peptide 1 CNGRCGGklaklakklaklak-CONH2 (Disulfide bridge: 1-5)	10861-01	1 mg	$783	Cart Inquire
NGR Peptide 2 CNGRCGGLVTT (Disulfide bridge: 1-5)	10862-01	1 mg	$828	Cart Inquire
NGR Peptide 3 CNGRC-CONH2 (Disulfide bridge: 1-5)	10863-01	1 mg	$845	Cart Inquire
NGR Peptide 4 CNGRCGGkklklllkll (Disulfide bridge: 1-5)	10864-01	1 mg	$1,133	Cart Inquire
NubO (68–75), Ndufa4 (68–75) VNVDYSKL	11004-01	1 mg	$710	Cart Inquire
Nuclear Export Signal, NES, Dok - 1 (348 - 359) LLKAKLTDPKED	11010-01	1 mg	$710	Cart Inquire
Nuclear Localization Signal Peptide PKKKRKV	10888-01	1 mg	$710	Cart Inquire
Pep - 1: Chariot (Non - Covalent Delivery of Peptide KETWWETWWTEWSQPKKKRKV	10884-01	1 mg	$579	Cart Inquire
proFIX18 TVFLDHENANKILNRPKR	11000-01	1 mg	$810	Cart Inquire
proFIX28 TVFLDHENANKILNRPKRYNSGKLEEFV	11001-01	1 mg	$1,148	Cart Inquire
Proprotein Convertase Substrate, PC4, Mca - labele Ac-KTKQLR-MCA	11016-01	1 mg	$912	Cart Inquire
proPT18 HVFLAPQQARSLLQRVRR	11002-01	1 mg	$810	Cart Inquire
proPT28 HVFLAPQQARSLLQRVRRANTFLEEVRK	11003-01	1 mg	$1,166	Cart Inquire
pro - ε - Tx1X/12 LKRTIRTRLNIR	10998-01	1 mg	$743	Cart Inquire
Rabies Virus Matrix Protein Fragment (RV-MAT) MNLLRKIVKNRRDEDTQKSSPASAPLDDG	10904-01	1 mg	$1,133	Cart Inquire
Renin FRET Substrate I	11067-01	1 mg	$1,115	Cart Inquire
SynB1 RGGRLSYSRRRFSTSTGRA	10885-01	1 mg	$828	Cart Inquire
TACE FRET Substrate I	11069-01	1 mg	$1,166	Cart Inquire
TAT (47 - 57) GGG - Cys(Npys) YGRKKRRQRRRGGG-C(Npys)-CONH2	10880-01	5 mg	$801	Cart Inquire
TAT (47-57)-Lys(TAMRA) YGRKKRRQRRRK(TAMRA)	10893-01	1 mg	$1,182	Cart Inquire
Tat (48-57) GRKKRRQRRR	10895-01	1 mg	$675	Cart Inquire
Tat-NR2Bct YGRKKRRQRRRKLSSIESDV	10892-01	1 mg	$783	Cart Inquire
TAT-NSF222 Fusion Peptide YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE	10901-01	1 mg	$1,040	Cart Inquire
TAT-NSF222scr Fusion Polypeptide scrambled YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE	10898-01	1 mg	$1,025	Cart Inquire
TAT-NSF700 Fusion Peptide YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL	10900-01	1 mg	$1,080	Cart Inquire
TAT-NSF700scr YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL	10897-01	1 mg	$1,025	Cart Inquire
TAT-NSF81scr Fusion Polypeptide, scrambeled YGRKKRRQRRR-GGG-QDGCKYFATDETIMKLSIAI	10899-01	1 mg	$1,350	Cart Inquire
TNO211 DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2	14531-01	1 mg	$837	Cart Inquire
Transdermal Peptide ACSSSPSKHCG	10896-01	1 mg	$405	Cart Inquire
Transglutaminase Substrate, biotinylated Biotin-TVQQEL	11015-01	1 mg	$845	Cart Inquire
Transportan GWTLNSAGYLLGKINLKALAALAKKIL	10887-01	1 mg	$783	Cart Inquire
ε - TxIX12 ECCEDGWCCTAA	10999-01	1 mg	$828	Cart Inquire
(Z - Phe - Arg)2Rh110 (Z-FR)2Rh110	10992-01	1 mg	$1,317	Cart Inquire

Show Rows :

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45 years of delivering high-quality, fast, and scalable synthetic biology solutions.

Greetings, Researchers,

Please be advised that any information, guidelines, write-ups, and oral/video/graphic content on our website are intended solely as general guidelines.

It is the researcher's sole responsibility to conduct thorough research on the design of products intended for their experiments before submitting
their designs to Biosynthesis for production feasibility review.

Thank you for your understanding.

Quick Links

Email : info@biosyn.com
Toll Free: 800.227.0627 | 1.972.420.8505
Bio-Synthesis Inc, 800 Mario Court, Lewisville, TX 75057